PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29736.m002027
Common NameLOC8287007, RCOM_0697810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Whirly
Protein Properties Length: 271aa    MW: 30241.1 Da    PI: 9.8919
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29736.m002027genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly221.19.4e-69942321139
         Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkv 96 
                    s+yk+kaal+v++++p+f aldsg++k+ r+G++ll++a+a+++r+ydW++kq+f+ls+te++++++l++++sceffhdp +++s+eGk+rk+lkv
  29736.m002027  94 SIYKGKAALTVEPRAPEFAALDSGAFKVAREGFVLLQFAPAAGVRQYDWSRKQVFSLSVTEIGTIISLGARDSCEFFHDPNKGKSDEGKIRKVLKV 189
                    7*********************************************************************************************** PP

         Whirly  97 ePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                    ePlpdGsG+f+nlsv+n+ ++ +es+++Pv+kaefavl+s+++
  29736.m002027 190 EPLPDGSGHFFNLSVQNKPMNMDESIYIPVTKAEFAVLISAFN 232
                    ****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.1E-7885251IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.65E-7687271IPR009044ssDNA-binding transcriptional regulator
PfamPF085364.0E-6295229IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MLSSPVTSTQ NPKLWTPNTF SSLQSFRTTS TTFIHTISAP RRLSTNTNRA VKCRQSEFYD  60
QQQQKYNPSR PSSNDSSFAS QSPAAVPRVY VGHSIYKGKA ALTVEPRAPE FAALDSGAFK  120
VAREGFVLLQ FAPAAGVRQY DWSRKQVFSL SVTEIGTIIS LGARDSCEFF HDPNKGKSDE  180
GKIRKVLKVE PLPDGSGHFF NLSVQNKPMN MDESIYIPVT KAEFAVLISA FNYILPYLLG  240
WHTFANSIKP DLNGHMNNAN PRFGGDYEWS R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1128427033219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1128427033219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1128427033219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1128427033219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520128.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-119WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLB9S2A90.0B9S2A9_RICCO; Putative uncharacterized protein
STRINGVIT_01s0026g01720.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-120ssDNA-binding transcriptional regulator